PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016495501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 858aa    MW: 97709.5 Da    PI: 8.725
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016495501.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.16.6e-1318106198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+ + ++++k+    +p +f+ ++g + +    ++le +sg  W+vkl  +++ g+ +l++GW +F +   +  g f++F+++g+s f   v+
  XP_016495501.1  18 FFKIILFPHASKL---HIPDEFVMKYGANMRD--LVSLEVPSGALWKVKL--QNSNGMAWLKEGWDQFKEYYSIGCGYFLLFQYNGNSHF--SVS 103
                     5666666666665...5*********988655..8***************..**********************************9999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016495501.1 104 IFD 106
                     987 PP

2B356.64.5e-18741836199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f+  + p +v+++ +l +p +f++++ ++  e+  ++l+ ++gr+W+ +++++ +  r+  + GW+eF+ +ngLk+ D++vF+l++  e  l+++
  XP_016495501.1 741 FIVSMQPTHVSRNFLLNIPGNFFRRYFKE--EEAFVILRASDGRTWRARCSFQSNCARI-HSPGWREFALDNGLKVHDTCVFELMEGIELVLNIT 832
                     67789999******************755..4457****************99998885.577*********************98877778888 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +fr+
  XP_016495501.1 833 IFRA 836
                     8886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.61715108IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-1915108IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-2015115IPR015300DNA-binding pseudobarrel domain
CDDcd100172.41E-1516106No hitNo description
SMARTSM010191.4E-1218108IPR003340B3 DNA binding domain
PfamPF023621.9E-1018106IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-23735839IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-22735839IPR015300DNA-binding pseudobarrel domain
CDDcd100174.42E-21739835No hitNo description
SMARTSM010191.1E-14741837IPR003340B3 DNA binding domain
PROSITE profilePS5086313.592741837IPR003340B3 DNA binding domain
PfamPF023629.8E-17741836IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MVKRRRQAVN VAEITPQFFK IILFPHASKL HIPDEFVMKY GANMRDLVSL EVPSGALWKV  60
KLQNSNGMAW LKEGWDQFKE YYSIGCGYFL LFQYNGNSHF SVSIFDLSAS EIEYPSGPSE  120
DMTPENFVKI VGDASHIKKE VGPETNNNAC DDIVDDLLRK KTAKVTKVAD HSYPRRQRSG  180
VPEWQDPIRV NLEKPDVEED LYCATDKEKR KEIKKEKLEK QNMEKNLYHA ADKGKAEHCK  240
EVLDPPASKM TNTSRCNKRK YSTSLEAPHC RHPLRSKSKP VEVVKLDQSK TEGTMHCVKP  300
KNTVVADSSH SGRQKTAAPI SCPETIEPKT KPEKVNLEED FHCAAPKARR GETNMEKLEK  360
QVVQQNVYAE AYKFKEHCNE VPVVDSSASK MTTTNQQSEK KTTINLDASC CRYPLRSKQL  420
KEVKLEKRDT EEDLFCAAQK AKKTETNRVK LDKGDAEEHC IEVPVVDPSA PKMTTTNQHT  480
EKKTAMSSDV LHCRYPLRSK QLKDVMIEKR DLKEHCNEVS VVDLSASKMI TTNRHTEKKT  540
ATSLDASWCR YPLRSKQLKD VKIEKRDVEE HCNKLPVMDP SASEMTTTNQ HSGKKTATSL  600
DVSRCRYPLR SKQLKEVKLE QWGGEKNMHN LKPKNKVVAD SPYCERQNSG LPASSPSFHP  660
EKKEPIRVKL EKPDVEEDLF CAAQKAKMKV INNVKLEIGD VEGNLNSAAY KVKASEMTNT  720
WQEKGYTLID AQCSKLGNPY FIVSMQPTHV SRNFLLNIPG NFFRRYFKEE EAFVILRASD  780
GRTWRARCSF QSNCARIHSP GWREFALDNG LKVHDTCVFE LMEGIELVLN ITIFRADSCF  840
LKDNLPLCGQ GRDSVTVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1471483722143B3 domain-containing transcription factor VRN
4i1k_B1e-1471483722143B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797235.10.0PREDICTED: uncharacterized protein LOC104243691 isoform X1
RefseqXP_016495501.10.0PREDICTED: uncharacterized protein LOC107814576 isoform X1
TrEMBLM1B5P70.0M1B5P7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000376880.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA132901215
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-22B3 family protein